Primary, secondary, and tertiary structure of the core of a histone H1-like protein from the sperm of Mytilus

L. Jutglar, J. I. Borrell, J. Ausio

Producció científica: Article en revista indexadaArticleAvaluat per experts

37 Cites (Scopus)

Resum

We have analyzed the structure of the trypsin-resistant core of the protein PL-II* of the sperm from Mytilus californianus. The peptide has a molecular mass of 8436 Da and its primary sequence is ATGGAKKP STLSMIVAAIQAMKNRKGSSVQAIRKYILANNKG INTSRLGSAMKLAFAKGLKSGVLVRPKTSAGA SGATGSFRVG. This sequence bears an enormous homology and fulfills the constraints of the consensus sequence of the trypsin-resistant peptides of the proteins of the histone H1 family. Secondary structure analysis using Fourier-transform infrared spectroscopy as well as predictive methods indicate the presence of 20-30% β-structure and ~25% α-helix for this peptide. As in the case of histone H1 proteins, the protein PL-II* core exhibits a compact globular structure as deduced from hydrodynamic measurements. The presence of a histone H1 protein with protamine-like features, seems to be thus, a common general feature of the chromatin composition in the sperm of the bivalve molluscs.

Idioma originalAnglès
Pàgines (de-a)8184-8191
Nombre de pàgines8
RevistaJournal of Biological Chemistry
Volum266
Número13
Estat de la publicacióPublicada - 1991

Fingerprint

Navegar pels temes de recerca de 'Primary, secondary, and tertiary structure of the core of a histone H1-like protein from the sperm of Mytilus'. Junts formen un fingerprint únic.

Com citar-ho